PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID EMT27450
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Aegilops
Family NAC
Protein Properties Length: 410aa    MW: 44336.6 Da    PI: 9.411
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
EMT27450genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM159.81.1e-49391642128
       NAM   2 ppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlskkgelvgl 102
               +pGfrFhPt+eel+ +yL++kvegk++++ e i+ +d+y+++Pw+Lp+ ++ +ekew+f+++rd+ky++g+r+nr+t+sgyWkatg d+ + +++++ +gl
  EMT27450  39 MPGFRFHPTEEELIEFYLRRKVEGKRFNV-ELITFLDLYRYDPWELPALAAIGEKEWFFYVPRDRKYRNGDRPNRVTASGYWKATGADRMIRAENNRSIGL 138
               79***************************.89***************8778899*********************************************** PP

       NAM 103 kktLvfykgrapkgektdWvmheyrl 128
               kktLvfy+g+apkg++++W+m+eyrl
  EMT27450 139 KKTLVFYSGKAPKGVRSSWIMNEYRL 164
               ************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5100555.28238185IPR003441NAC domain
SuperFamilySSF1019413.01E-5538184IPR003441NAC domain
PfamPF023651.0E-2440164IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 410 aa     Download sequence    Send to blast
MSSRHEGGGH GAAAAAAGAG VGSIKEGGGR DAHEDDLVMP GFRFHPTEEE LIEFYLRRKV  60
EGKRFNVELI TFLDLYRYDP WELPALAAIG EKEWFFYVPR DRKYRNGDRP NRVTASGYWK  120
ATGADRMIRA ENNRSIGLKK TLVFYSGKAP KGVRSSWIMN EYRLPTADTD RYHKTEISLC  180
RVYKRTGIDD GRGHPSSARS TMPSRRGAEA RQDNRQGASS TSTPTPPPTP STLQLLQAGE  240
CTSPPAPMTD HAQTHRPAAP RRHLAATLKP SGGSLGYLQS TAATGDHQQE AAAALLYQQY  300
SKSTNTFAST YSLLNLVNAA SMGVASAAAI DELSTLVGHG AAQLPSYHSP ASSGGHHDHF  360
VVPLPTPPTQ PITPLGTLPM SLAAISDKIW DWNPIPDAAA GRDYGGAGFK
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4dul_B6e-544018519165NAC domain-containing protein 19
4dul_A6e-544018519165NAC domain-containing protein 19
1ut7_B6e-544018519165NO APICAL MERISTEM PROTEIN
1ut7_A6e-544018519165NO APICAL MERISTEM PROTEIN
1ut4_B6e-544018519165NO APICAL MERISTEM PROTEIN
1ut4_A6e-544018519165NO APICAL MERISTEM PROTEIN
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00257DAPTransfer from AT2G02450Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankFR8197620.0FR819762.1 Hordeum vulgare subsp. vulgare mRNA for NAC transcription factor (NAC012 gene).
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004970843.11e-168PREDICTED: protein CUP-SHAPED COTYLEDON 1
TrEMBLM8BR170.0M8BR17_AEGTA; Putative NAC domain-containing protein 9
STRINGMLOC_57215.10.0(Hordeum vulgare)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP28263787
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G02450.11e-101NAC domain containing protein 35